SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1SQZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1SQZ1
Domain Number 1 Region: 6-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-80
Family Capz alpha-1 subunit 0.0000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1SQZ1
Sequence length 298
Comment (tr|F1SQZ1|F1SQZ1_PIG) Capping actin protein of muscle Z-line alpha subunit 3 {ECO:0000313|Ensembl:ENSSSCP00000000620} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=CAPZA3 OC=Sus.
Sequence
MSLSVLSRKEKEKAIRRLLIQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYS
VPLSIDGNAVLLSHHNVVGDYRFFDYQSKLSFKFDLLQNQLKDIQSHGIIRNETEYLRTV
VLCALKLYVNDHYPKGNCNVLRKTVKNKEFLIACIEDHSYNSDFWNGLWKSKWIFQINPF
LTQVTGRIFVQAHFFRCVNLHVEISKDLKESLEVVNQAQLALNFARLVEEQENKFQAAVL
EELQELSNEALRRIIRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII
Download sequence
Identical sequences F1SQZ1
ENSSSCP00000000620 9823.ENSSSCP00000000620 XP_003126496.1.46622 ENSSSCP00000000620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]