SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1TAV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F1TAV3
Domain Number - Region: 82-173
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00471
Family Capz alpha-1 subunit 0.06
Further Details:      
 
Domain Number - Region: 160-202
Classification Level Classification E-value
Superfamily EF-hand 0.0311
Family S100 proteins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1TAV3
Sequence length 308
Comment (tr|F1TAV3|F1TAV3_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EGD48646.1} KW=Complete proteome OX=588581 OS=[Clostridium] papyrosolvens DSM 2782. GN=Cpap_3069 OC=Ruminiclostridium.
Sequence
MKNPKYKKILVSFLIGALILQAGFIGYSMIGNVTLGFKSKNVGVSPHTEVRNQIDSNGKS
EATGVVKEDNNIKDQTSNEISQEILGLIKSADPDNYNRNVDNYRKLLKDLNVHIIYKNEI
ERLMKKGFKVPDILTSYTFLNDCYGNMNYLEAFLKEKKKGMEWADIFKEYNKKHPTFMPS
NFDSMYLDKLLKTQDINQDDLIIADRVSQNAKVDFSDVINKRINGVSLRAINDQYKIVNG
LEESPHLNVTGEQLERYATQSKLTEEEVIDALTISRKLGSSADSVLKSMKQGLSKEEIYA
GAYLKKFN
Download sequence
Identical sequences F1TAV3
WP_004617847.1.91191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]