SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2D3G0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2D3G0
Domain Number 1 Region: 12-295
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-83
Family Capz alpha-1 subunit 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2D3G0
Sequence length 306
Comment (tr|F2D3G0|F2D3G0_HORVV) Predicted protein {ECO:0000313|EMBL:BAJ89631.1} OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
MSDDGGAGEPLSGDQKREIAVWFLANAPAGEIHYVAKDVRALLGDDAAYEAAAAEAYPEY
NKTQLVSLELPDRSGDIIITTYGELDRNNYLDPRTAQVATVDHVKQTCTKLRPAADEELP
SGYIEEFRNAIDYEVSKYVGEAYPKGVSAVYCTNGKDVEGPGADFALAVVISAARRSPQN
FCNGSWRSVWTLEFSYAFQLVEIKGKIQVGAHYFEEGNVQLDTDVDRKDSTILQSPEDTG
HTVATIIRHQESEYFSSLEESYLNLSDATFKDLRRKLPVTRTLFPWHNTHAISLTRDLAK
ELGIGK
Download sequence
Identical sequences F2D3G0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]