SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2DL01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2DL01
Domain Number 1 Region: 5-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.18e-84
Family Capz alpha-1 subunit 0.00000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2DL01
Sequence length 273
Comment (tr|F2DL01|F2DL01_HORVV) Predicted protein {ECO:0000313|EMBL:BAJ95772.1} OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
MSDLETVSAFVEGAPPGELADVIADIKSLTLETSPDIISSLGPAFEKYNEEQFVTVKLPG
SSQPVIISSHNSFGDGRYYDVESSSSFAFDHTTQKASAVQSHVLEGAQADLVKSTLKSIG
PYVDEHFANAAHGVYPIESDSKIAIVIVGNKYSPNNFWNGRWRSLYILDPSSGALEGSLK
VDVHYYEDGNVRLLTNKPVSSTVSSVNGASIVREISTTERKYQEELNKGFVSLSEGAFKG
LRRQLPVTRQKIEWDRVTSYRLGQDIGGGSSRR
Download sequence
Identical sequences A0A0J0DT94 F2DL01 S0E782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]