SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2QUA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2QUA9
Domain Number 1 Region: 2-253
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.68e-55
Family Capz alpha-1 subunit 0.0000758
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F2QUA9
Sequence length 260
Comment (tr|F2QUA9|F2QUA9_KOMPC) Capping protein heterodimer subunit alpha {ECO:0000313|EMBL:CCA38987.1} KW=Complete proteome OX=981350 OS=Y-11430 / Wegner 21-1) (Yeast) (Pichia pastoris). GN=PP7435_Chr3-0013 OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Komagataella.
Sequence
MSIISEFVQDIPPGEAKPVIRDLKLVAAEFGAEIKNEFETHVLNSDFHLVQDTSQGLLAI
VSRYTQRGTKFIDYASNLKFHYDFVDQKSMDTEEFSEDILPEYNSVDKELEKYTQEHFPD
SYKVVLTPFEEGFHVIIVDVRYNDKNFYNGKWQSFYTFNRVKGLISGQVRIKIHYYEDGN
VTLNSHKRLNPTETTVTDIVNHIKSFEDDYQRNLLSSFNNLNEIVFRNLRRQLPINRSKV
QWGKSIGTYKLGQDIGGGRE
Download sequence
Identical sequences F2QUA9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]