SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2TW64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2TW64
Domain Number 1 Region: 33-155
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-27
Family Capz alpha-1 subunit 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F2TW64
Sequence length 163
Comment (tr|F2TW64|F2TW64_SALR5) Uncharacterized protein {ECO:0000313|EMBL:EGD72310.1} KW=Complete proteome; Reference proteome OX=946362 OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021). GN=PTSG_00328 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Salpingoeca.
Sequence
MFRTGICCSPCISTTNNQPKATTKMDYDEDIPDEEKVQIAKDFLANAPPGEFNEVFNDVR
VLLDNDALLKQAGEEAFSTYNEDQFMIAKVDEDNVLVTTAGRTADGRYKHPSKSKVFSFD
HLRRTVDEIADGEAPGQASLRDEVEAAAHDYAKEEHRRACVAR
Download sequence
Identical sequences F2TW64
XP_004998880.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]