SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F3V2P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F3V2P9
Domain Number - Region: 97-149
Classification Level Classification E-value
Superfamily Baseplate structural protein gp8 0.0432
Family Baseplate structural protein gp8 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F3V2P9
Sequence length 165
Comment (tr|F3V2P9|F3V2P9_SHIDY) Entry exclusion protein {ECO:0000313|EMBL:EGJ02305.1} KW=Complete proteome OX=766142 OS=Shigella dysenteriae 155-74. GN=SD15574_0690 OC=Enterobacteriaceae; Shigella.
Sequence
MIYYSAQLFSIKTITYLSDTGCLEIQGASLVFMLFFIVLWQGLFIWLLSQIRKKRNVSDE
FKFSKGVWYITMPVSSLLSPLLSLMVFIIGTLYELRRVSGCISIKKWGQNQLKNQYDGSE
KLDFGGIEQPPTTYYNPSTGYPMHGGFDSAGNTFGTRWQDYYDRQ
Download sequence
Identical sequences F3V2P9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]