SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4C4C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4C4C9
Domain Number 1 Region: 429-478
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0000000000353
Family Rubredoxin 0.0032
Further Details:      
 
Weak hits

Sequence:  F4C4C9
Domain Number - Region: 2-48
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0014
Family Duplicated SiR/NiR-like domains 1 and 3 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4C4C9
Sequence length 479
Comment (tr|F4C4C9|F4C4C9_SPHS2) Rubredoxin-type Fe(Cys)4 protein {ECO:0000313|EMBL:ADZ80291.1} KW=Complete proteome; Reference proteome OX=743722 OS=Sphingobacterium sp. (strain 21). GN=Sph21_3755 OC=Sphingobacteriaceae; Sphingobacterium.
Sequence
MKAKEQYIVKINLPGGIISAGNLLRVLKVLQELGIETVSFGNRQQLLFSAATEHLHHLRL
NIPNSIMEVNGDDYPNIVSSYVTEEVFAPIGWLREGVYKDILDSFNYHPRLKINIVDRHQ
NLIPFFTGNFNFISSDISNHWYLHVRFPKTNKIYPWPSLIYSADIAEISRLLELIIMDND
HLFYNTPNADGDQLVQMLNRMADFHTQHYDLPMTHTDFHLPFYEGINYYGEHKLWLGIYR
RWENFFVDFLIEICTLCMDCRIGQLYTTPWKTILIKNILPSYRIRWSVLLNKYRINVRHA
SNELNWQLEDRSDEAKELKWLLVKAFEEADLRTSKLCFAIKISKQTGLFGSIIIQKEISE
ETLYHVMHTSNFNPNSKEFVDYGSAGDIKELGELLIRLCNVYYEMHSTLRLSVTPKKEVN
SKKNDAPAQIYQCKHCFTRYDPLYGDSINSISPGTSFDLLVDYSCPTCDARKAEFERVF
Download sequence
Identical sequences F4C4C9
gi|326801142|ref|YP_004318961.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]