SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4D6P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F4D6P9
Domain Number - Region: 44-98
Classification Level Classification E-value
Superfamily Staphylokinase/streptokinase 0.085
Family Staphylokinase/streptokinase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4D6P9
Sequence length 179
Comment (tr|F4D6P9|F4D6P9_HELPX) Uncharacterized protein {ECO:0000313|EMBL:AEE70674.1} KW=Complete proteome OX=585538 OS=Helicobacter pylori 83. GN=HMPREF0462_1070 OC=Helicobacteraceae; Helicobacter.
Sequence
MRFKSVVAFISLAVALGVLTYLLLSVKEEMSAISHADKNLSQTDAKSHDINLEENSPNEV
SHNENETSHNEKAPHNEEDRNNALSQNLDAQEVINYPVIEHHFEIPFEEKKREYSKLIIK
DLKGYQWWCLKEILKKEQIDYAYDNTKNQPNLIIYLDKNKKERFLADLDYYKIRYHAVF
Download sequence
Identical sequences F4D6P9
WP_001211384.1.101717 gi|385225711|ref|YP_005785636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]