SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4J7C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4J7C4
Domain Number 1 Region: 13-297
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-85
Family Capz alpha-1 subunit 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4J7C4
Sequence length 382
Comment (tr|F4J7C4|F4J7C4_ARATH) Subunits of heterodimeric actin filament capping protein Capz superfamily {ECO:0000313|EMBL:AEE74253.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F22F7.25 OC=Arabidopsis.
Sequence
MADEEDELLETELSYDQKKEIAKWFFLNAPAGEINYVAKDLKAVLSDEEVYNEAAMEAFP
VYNKTHMICLEMPSGAGDVIVSSYSEINENEYLDPRTAQVAIVDHVKQICTKVRPANDEE
LPSLYIEEYRYALDAEIQRYVSESYPKGMSAVNCVKGKDNEGPGSDFELVVIITAMRLSP
QNFCNGSWRSVWNIDFQDESQVLDIKGKLQVGAHYFEEGNVELDAKKDFQDSTIFQSADD
CAIAIANIIRHHETEYLASLEVAYSKLPDNTFKDLRRKLPVTRTLFPWQNTLQFSLTREV
EKELGLGKISIISVVSCLSFGVMYTNRISKYDRYCSASRMKELKFGPKKSSVAGNRTRVS
WVKARYPNRWTTTDMLLELLKN
Download sequence
Identical sequences F4J7C4
NP_001154593.1.80155 3702.AT3G05520.2-P AT3G05520.2 AT3G05520.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]