SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4P5P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4P5P4
Domain Number 1 Region: 4-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.14e-75
Family Capz alpha-1 subunit 0.00000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4P5P4
Sequence length 280
Comment (tr|F4P5P4|F4P5P4_BATDJ) Uncharacterized protein {ECO:0000313|EMBL:EGF79220.1} KW=Complete proteome; Reference proteome OX=684364 OS=chytrid fungus). GN=BATDEDRAFT_89535 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence
MTATDAEKLEIVSGFIKDSPPGEINDVFNDVRSLVADDSLLQNTIESTFADHHAKQLVSV
QVPSKDYEVILGEYGCIEPSKYVDPRSGQALIVDLVHQTVKSVEPYHSKCSAHLLDQRAA
LDVAVQEYTASFYPSSVCTVWATEDEALVIAIVANKYHPDSFWSGRWRSLWRLEPKSSML
TGSAKVQVHYYEDGNVQHNSTQDYSVSITASDQEPSTLAATVIKHISKLEAEYQTTLNDQ
HNRLALETFKSLRRALPISRTKIEWQGILSYKIGSELVSK
Download sequence
Identical sequences F4P5P4
XP_006680060.1.45406 jgi|Batde5|89535|GP3.050940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]