SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4PM00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F4PM00
Domain Number - Region: 7-63
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0549
Family Capz beta-1 subunit 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4PM00
Sequence length 342
Comment (tr|F4PM00|F4PM00_CAVFA) Uncharacterized protein {ECO:0000313|EMBL:EGG22703.1} KW=Complete proteome; Reference proteome OX=1054147 OS=fasciculatum). GN=DFA_04833 OC=Cavenderiaceae; Cavenderia.
Sequence
MIISKKVVSSSNLLKRFIVSSTNNYGTNNNQIYTTNNNRNIICKYNSNIHSVSSRYYSTN
NNKKEEQEEEEEDGVDDDGIDVKQRERIRRAMLEKVAASHKKSTETLQAHNLNNNDKTNT
TTTTAKGNTTTTKQDEIDQDENNTDQKDKEQGQAEGEKKEEKVYDRDNFAHFSQTKFIYT
IFGASLLTMIGFAIRGALSDGSSFQMPYDNNLILRDIFDDYHNLYEDCEEFKKIIPPQST
AIVDKFIQVEVQKDTLSFTIPILQKATMSLVATYNIDFYKEGDVFKCSNLYLDVVNGKHF
VIDHPNHEYNTTSPKYTLSMLMNQHENLERQKKLMEEKEAAH
Download sequence
Identical sequences F4PM00
XP_004360554.1.3806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]