SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4QDP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4QDP8
Domain Number 1 Region: 2-277
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-84
Family Capz alpha-1 subunit 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4QDP8
Sequence length 283
Comment (tr|F4QDP8|F4QDP8_CAVFA) Subunit of heterodimeric actin capping protein cap32/34 {ECO:0000313|EMBL:EGG13845.1} KW=Complete proteome; Reference proteome OX=1054147 OS=fasciculatum). GN=DFA_11606 OC=Cavenderiaceae; Cavenderia.
Sequence
MATNEEIVKIATNFILSAPAGELNEVVSDVRALLPNESMLNASAAETFREYNTEQMVIAN
SPKGHKVLITKKGEVSHNEYLDPKAKLVLTFDHIKQTVTGSRAAGSELDSEVESYRAAFE
EEAVKYTNEFYPSGVATVYGQKVSEGYQITVCVSSSKFNPNNYWNGRWRSTWTSTFKPGS
GNVTINGKMQINVHYYEDGNVQLNTTTTKSTTAASADANTTASNVFKAIGKAELNVHAAL
DTSYSTMGDTTFKALRRALPITKMKINWTKIKGHRVGAELSNK
Download sequence
Identical sequences F4QDP8
XP_004350553.1.3806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]