SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4S5P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F4S5P0
Domain Number - Region: 597-688
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0628
Family Capz alpha-1 subunit 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4S5P0
Sequence length 874
Comment (tr|F4S5P0|F4S5P0_MELLP) Uncharacterized protein {ECO:0000313|EMBL:EGG00062.1} KW=Complete proteome; Reference proteome OX=747676 OS=leaf rust fungus). GN=MELLADRAFT_112196 OC=Pucciniomycetes; Pucciniales; Melampsoraceae; Melampsora.
Sequence
MIPKQVFLSFTREILTPRTIEKNLKENGYRKGQDCFKFSSEKIHDDLNTLVQPISVESII
LGNWKVSENDQVMSFDQKIPNGLENDLTMIDHHPFTNHYKGYHLDDINSVMSSWDEFENP
KETTPMDSPRIKPSEGTLSKNKALKAPCSMDSRQSDTQDHLAKDKTKRRDLHIGKYVGLQ
PTLSSKKIRKSKAMKDLLKSTKSVSSSESNDVISIETIEKNWLKKKTRKMPDLDNVLKST
SVVDYSNGDLSSVDNPLKGEIPYCNNKKCVSQDNNVKAKFPYPASERDQRANHIQKHAKP
TKKESKSDEKFRKQLEQIMRPVSEHFENLANIQLTGINKELKYPNASKKTTKPLGQSPDH
SIGKDATESREQVMDKGLENLASQAIKSNKKASEYDSESVEERKIRELESMNTNNDSNEP
FQNAKRKHASVSEAQGIQQSTALHEWNEYKRKSDRSTPAKLLRTKNLEDISGSKTNRHEI
GSQSEHVLTIIALELKNILDIQLSGSSTVNGKRTEDIHGYEQSIQIDTTNDWRSKTKRKQ
KKMFPADDHTDSQQIPENILSEKVIPKQNERKTQLSSQEMTNPSTRKPKQVNPPSNNSSL
LIKIRNHLRQQGEVHRSFRRSHEESYRKTRDLVFTYAHQGKQIIEKNKELFEDMSRAYGS
VEKSMTKNLSRHLAQLNMKTFNSIVSFKAEHIIFPIFIRQVSWICKLTQDLSMITKDYKL
GEKFTNTPTVYVSASEFFRKWLKNKALEYLHYVEENINKPIWKDMNEHKESPRGNSSVQL
IHHLEFATLTPKWTVISWDIFWEWLKTYDSTLHELTQIQNPKTQNLLRQFKIHYAREVMQ
QMIEKDGQFFEMEFCIEHKIPRGKFKRLKSETLY
Download sequence
Identical sequences F4S5P0
jgi|Mellp1|112196|fgenesh2_pg.62_#_72 XP_007416660.1.63152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]