SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4WYV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4WYV2
Domain Number 1 Region: 10-270
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.24e-102
Family Capz alpha-1 subunit 0.0000000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4WYV2
Sequence length 275
Comment (tr|F4WYV2|F4WYV2_ACREC) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EGI60606.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_11166 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MAADGDAVIPDQEKVRIVSDFILHSPPGEFNEVFNDVRVLLAQYNKDQLTPVKIEGSEHP
ALITEHNDLGSQRFYDARSKQSFKYDHLRKEAQDYESYEPDPLAEPWRSALQEEITNYTQ
SHYRHGACSVFGKSLGGNITLTACIEDHQFQPKNFWNGRWRSVWTVSFTPSSGNAELRGS
LKVQVHYYEDGNVQLVSSKDVKESLPISNEKQTAKDLIRFVEESENDYQTAISENYQTMS
DTTFKALRRQLPVMRTKIDWNKIVSYSIGKELKSQ
Download sequence
Identical sequences F4WYV2
Aech_05688 XP_011062358.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]