SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F5L126 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F5L126
Domain Number - Region: 37-147
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0288
Family Capz beta-1 subunit 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F5L126
Sequence length 444
Comment (tr|F5L126|F5L126_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EGL77059.1} KW=Complete proteome OX=768727 OS=Veillonella parvula ACS-068-V-Sch12. GN=HMPREF9323_1372 OC=Veillonella.
Sequence
MTKLPLLACAFIMSTILSPIGAIDVNIPGADSKFSKDAYINYQTTNPDIEKDVANYVKTL
KLTDKANGINKNEIEYTKAASTYRGQNYHNTVISVHDQYNQIRLSFPVAGIKSDYHIGRY
QNPSRTIEDYRVLTNNGSLNLEIDYADFKDYDWRNTKIAYEKLTDKDVRNFLQDNAKRKS
SKQISDIKGTVFSYPTVTYSTWDSMKMPHFKNGKKTTLTIDTINFKFKGYNMRHPLYHAG
FVYYDNNPVLNKVPTDKLLANYVLPSVQNLNELNQYSRIESLNGVQYRVPKDAIYEGESK
GSEHQDIRYYKKGDITFFVSTDNVPRNPYAHELVINGHYNFKTDLNTFWDIYRYHPSASD
YINYSVVWNNNIPGLSIHSYEPNKDDHILNFNSYDGIYSFTYTIFYPRFLSAEEVQKLRN
MIEFFDSTNNPNFKMQEHVLFPEA
Download sequence
Identical sequences F5L126
WP_004698279.1.1161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]