SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6I4M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6I4M2
Domain Number 1 Region: 12-296
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-82
Family Capz alpha-1 subunit 0.00000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6I4M2
Sequence length 307
Comment (tr|F6I4M2|F6I4M2_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CCB61859.1} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_14s0060g02220 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MADDGECGEVEMSDEQKKEIAKWFLLNSPAGEIQYVAKDLRSVLSDEDVYNEAASEAFPL
YNKSHMICLEMPGTTGDVLVTSFSELDKNEYLDPRTAHVAIIDHVKQVCTEVRPAADEEL
PSAYVEEFRCAMDAEILKYVSEAYPKGVCSVYCINGKDAEGPGCDFEFAVVISAARHSPQ
NFCNGSWRSIWNIEFKDDMQMLEVRGRLQVGAHYFEEGNVQLDAKHECKDSTIFQSPEDC
AISIANIIRHHETEYLTSLQASYSNLPDTTFKDLRRKLPVTRTLFPWHNTMQFSLSRDIS
KELGIGK
Download sequence
Identical sequences F6I4M2
XP_010659639.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]