SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6Q0S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6Q0S1
Domain Number 1 Region: 316-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000293
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 2 Region: 414-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000486
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 470-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000093
Family Laminin-type module 0.016
Further Details:      
 
Weak hits

Sequence:  F6Q0S1
Domain Number - Region: 517-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000707
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 54-71,111-194
Classification Level Classification E-value
Superfamily Sialidases 0.00157
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6Q0S1
Sequence length 588
Comment (tr|F6Q0S1|F6Q0S1_MONDO) Netrin G2 {ECO:0000313|Ensembl:ENSMODP00000015660} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=NTNG2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MLSPSFTPNPDAAFPGPLQARSSPPPPAVMLLLASLLLHCLPLAMGDYDICKSWVTTDEG
PSWEFYACQPKAMSMKDYVMVKVEPAGITCGDPPERFCTHENPYLCSDECDASNPDLAHP
PRLMFDKEDEGLATYWQSVTWSRYPSPLEANITLSWNKSIELTDDIVMTFEYGRPTIMML
EKSLDNGRTWHPYQYYAEDCMEAFNMPPRRVRDLSSTSANRVVCTEEYSRWAGSKKEKHV
RFEVRDRFAIFAGPDLRNLDNLYTRLESAKGLKEFFTATDLRMKLLRPALGGTYVQRENL
YKYFYAISNIEVIGRCKCNLHANLCSYKEGGLQCECEHNTTGQDCGKCKKNFRTRSWRAG
SYLPLPNGSPNACAAAGSAFGTATTVAVPAKISKLFQLKPKSPQVVPIEVFKDCECYGHS
NRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSIND
RCNETGHCECREGAAGPKCDDCLPSHYWRQGCFPNVCDDEYLLCQNGGTCYQNQRCLCPS
GYQGVLCDQPLCQGEEGQACNPAPHAGPHLAVFLGSGLLLWLAGCLGY
Download sequence
Identical sequences F6Q0S1
ENSMODP00000015660 XP_003339683.2.35504 ENSMODP00000015660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]