SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6QIQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QIQ9
Domain Number 1 Region: 8-160
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.06e-47
Family Capz alpha-1 subunit 0.000000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6QIQ9
Sequence length 172
Comment (tr|F6QIQ9|F6QIQ9_CALJA) F-actin-capping protein subunit alpha-2 {ECO:0000313|Ensembl:ENSCJAP00000024977} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=CAPZA2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAIESW
RTSVETALRAYVKEHYPNGVCTEWSLEVRMEVYNHSFNHSSGWHLENSGSLL
Download sequence
Identical sequences F6QIQ9
ENSCJAP00000024977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]