SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6W9C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6W9C9
Domain Number 1 Region: 8-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.71e-95
Family Capz alpha-1 subunit 0.0000000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6W9C9
Sequence length 284
Comment (tr|F6W9C9|F6W9C9_CIOIN) Beta-actinin I {ECO:0000313|EMBL:BAM34031.1} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=CapZ-alpha OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MSDYGEQISDSEKQRIAHDFITHAPPGEVETVFSDVRHLLSKDGSAHGESMTASLSKYRV
DQFTPVTVDKEKVLLTNHGKLDNNRFLDPRSKKSFHCNIPKVEISDIQPADVDSNAESWR
NEIDNALAKYIKEHFPHGTCTVYGTSNGGETTIIACIEDHKFSPENFWNGRWRSEWKITI
EDGNAKVVGILKTQVHYYEDGNVQLVSQKECKDNLTVSSEKQLADDVTKLIMKFESDYQL
AINDNYNTLSTTTFKALRRQLPVTRTKIDWNKILGYQIGKEIGK
Download sequence
Identical sequences F6W9C9
ENSCINP00000002575 ENSCINP00000002575 NP_001265887.1.78797 7719.ENSCINP00000002575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]