SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6WKV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WKV8
Domain Number 1 Region: 13-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.67e-113
Family Capz alpha-1 subunit 0.000000000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6WKV8
Sequence length 286
Comment (tr|F6WKV8|F6WKV8_HORSE) F-actin-capping protein subunit alpha-2 {ECO:0000313|Ensembl:ENSECAP00000019129} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=CAPZA2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MADLEEQCLXXXXVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPYEAENAVESW
RTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
ITPSTAQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences F6WKV8
ENSECAP00000019129 ENSECAP00000019129 9796.ENSECAP00000019129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]