SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6WWW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WWW7
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.15e-103
Family Capz alpha-1 subunit 0.000000000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6WWW7
Sequence length 273
Comment (tr|F6WWW7|F6WWW7_HORSE) Capping actin protein of muscle Z-line alpha subunit 1 {ECO:0000313|Ensembl:ENSECAP00000014750} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=CAPZA1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
VRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQ
VLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGGLKSWRESCDSALKAYVK
DHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLK
IQVRSQHDVKLSLVFIKLPQASVSSSNEAQTAKEFIKIIEHAENEYQTAISENYQTMSDT
TFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences F6WWW7
9796.ENSECAP00000014750 ENSECAP00000014750 ENSECAP00000014750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]