SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6YHZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YHZ8
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.92e-42
Family Capz beta-1 subunit 0.000000554
Further Details:      
 
Domain Number 2 Region: 157-186
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000000392
Family Capz beta-1 subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6YHZ8
Sequence length 188
Comment (tr|F6YHZ8|F6YHZ8_MOUSE) F-actin-capping protein subunit beta {ECO:0000313|Ensembl:ENSMUSP00000114973} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Capzb OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLSVGFLVLTEP
EEEVLPAPHRARLLLDSIARHSECVVMSTGLSDSLPERYFEGGVSSVYLWDLDHGFAGVI
LIKKAGDG
Download sequence
Identical sequences F6YHZ8
ENSMUSP00000114973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]