SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YIX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YIX2
Domain Number 1 Region: 343-414
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.96e-16
Family Intermediate filament protein, coiled coil region 0.0029
Further Details:      
 
Weak hits

Sequence:  F6YIX2
Domain Number - Region: 109-136
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000167
Family Intermediate filament protein, coiled coil region 0.0052
Further Details:      
 
Domain Number - Region: 116-210
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00105
Family Myosin rod fragments 0.016
Further Details:      
 
Domain Number - Region: 302-362
Classification Level Classification E-value
Superfamily G protein-binding domain 0.0251
Family Rabaptin-5 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6YIX2
Sequence length 414
Comment (tr|F6YIX2|F6YIX2_XENTR) Beaded filament structural protein 2 {ECO:0000313|Ensembl:ENSXETP00000059181} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=bfsp2 OC=Silurana.
Sequence
LAIERLRPETVVGSSSIMPLPRRRSSILGQQHHYTSSECSGATNRVFCIAPRNPGVYVGS
ALSSGTSSLGTRVSRRALGISSVFMQGLRSSGPPVPAAQGLDKGRVPTFESLNSCLLEYI
DKVRALEQVNRELEDHIRVYLDKKSSTVSSWGTLRDKWESIYYQVGDAVLENARLMLQTE
NLQACAEDFKERYENEQPFRKAIQEEIRSLYKVIDDANLTKKDLESQIESMKEDLASLSK
NHKEDVKMLYKQLAGFQLEEMDVPIGTGLDDILETIRIHWEKDIEKNRAETGVLLQTKSV
ALPAAQDEVEELAENLKEEFHDTTCKIQSLQAETESLRTLKRGLENALHDAKHWHDIELQ
NLGSVITKLEAELEEIKMETEHQERDREQLVASKMHLEKDIAAYHAILDGEENR
Download sequence
Identical sequences F6YIX2
ENSXETP00000059181 ENSXETP00000059181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]