SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6ZF49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZF49
Domain Number 1 Region: 54-327
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-114
Family Capz alpha-1 subunit 0.000000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6ZF49
Sequence length 332
Comment (tr|F6ZF49|F6ZF49_MONDO) Capping actin protein of muscle Z-line alpha subunit 1 {ECO:0000313|Ensembl:ENSMODP00000001228} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CAPZA1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAQQQTEFPEGFSPPLQLRPLRWVHSSRFLPGLLRASRRAGPEQPKMADFEDRVSDEEKV
RIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQV
LITEHGDLGSGRFLDPRNKVSFKFDHLRKEAGDPQPEDIDGALKSWRESCDSTLRTYVKD
HYSNGFCTVYAKIIDGQKTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKI
QVHYYEDGNVQLVSHKDVQDSVTVTDDVQTAKEFIKIIEHAENEYQTAISENYQTMSDTT
FKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences F6ZF49
ENSMODP00000001228 ENSMODP00000001228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]