SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7D9Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7D9Y2
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Synuclein 6.02e-47
Family Synuclein 0.00000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7D9Y2
Sequence length 100
Comment (tr|F7D9Y2|F7D9Y2_XENTR) Gamma-synuclein {ECO:0000256|RuleBase:RU361225} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=snca OC=Silurana.
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK
EQVSNVGGAVVTGVTAVAQKTVEGAGNIAAATGLVKKDQK
Download sequence
Identical sequences F7D9Y2
ENSXETP00000051005 8364.ENSXETP00000051005 ENSXETP00000051005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]