SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7FSG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FSG7
Domain Number 1 Region: 28-245
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-84
Family Capz beta-1 subunit 0.00000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7FSG7
Sequence length 260
Comment (tr|F7FSG7|F7FSG7_MACMU) Capping actin protein of muscle Z-line beta subunit {ECO:0000313|Ensembl:ENSMMUP00000040555} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=CAPZB OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MPRQFQDTGFSHPGCGQPRRCDPEPRKSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPS
LCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLR
KLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVV
EVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVGDCSPHIANIG
RLVEVCADFCRQIKTRSSEE
Download sequence
Identical sequences A0A2K5TMH3 A0A2K6DEY3 F7FSG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]