SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GFM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GFM4
Domain Number 1 Region: 8-275
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-76
Family Capz alpha-1 subunit 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7GFM4
Sequence length 299
Comment (tr|F7GFM4|F7GFM4_MONDO) Capping actin protein of muscle Z-line alpha subunit 3 {ECO:0000313|Ensembl:ENSMODP00000022297} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CAPZA3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MNIRNKVSDKKKERAIQNLLTQAPPGEFRKSFDDLSLLVQDEKLMRQQGEWAGNKYCKKY
FVPLNIDGHQVLLAHHNELGDQRFFDSHSRLSFKFDVLENQLKDIESHGVLRNEAECLRM
VVSYALKIYVSNHFPSGNCNVLRKTIKNKEFLIACIEDHHYKVSNFWNGLWKSKWIFSVT
PFLTQVIGSIYVKAHFFKHINFHLDISKDVQDCLDVVNQAQLALGFAKFVEEQENKFQAA
VLEELQDLTIVLKKTLRRDLPVTRTYIDWQRIVNDMKLVMYPVHGYISYSKNALCNWIT
Download sequence
Identical sequences F7GFM4
ENSMODP00000022297 13616.ENSMODP00000022297 ENSMODP00000022297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]