SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GU68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GU68
Domain Number 1 Region: 6-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-79
Family Capz alpha-1 subunit 0.0000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7GU68
Sequence length 299
Comment (tr|F7GU68|F7GU68_CALJA) Capping actin protein of muscle Z-line alpha subunit 3 {ECO:0000313|Ensembl:ENSCJAP00000041937} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=CAPZA3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MALSVLSRKDKEKVIRRLLIQVPPGEFVNAFDDLCLLIRDEKLMHRQGECAGHQHCQKYS
VPLSIDGNPVLLSHHNVMGDFRFFDYQSKLSFKYNLLQNQLKDIRSHGVIRNETECLRVV
VLCALKLYVNDHYPKGNCNVLRKTVQSKEYLIACIEDHNYETGECWNGLWKSTWIFQVNP
FLTQVTGRIYVRAHFFRCVNLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAV
LEELRELSNETLRRILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII
Download sequence
Identical sequences F7GU68
ENSCJAP00000041937 XP_002752152.1.60252 ENSCJAP00000041937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]