SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7KG48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7KG48
Domain Number 1 Region: 148-280
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000000186
Family HD domain 0.033
Further Details:      
 
Weak hits

Sequence:  F7KG48
Domain Number - Region: 35-91
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00012
Family Single strand DNA-binding domain, SSB 0.028
Further Details:      
 
Domain Number - Region: 103-145
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0942
Family Capz alpha-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7KG48
Sequence length 314
Comment (tr|F7KG48|F7KG48_9FIRM) CMP-binding protein {ECO:0000313|EMBL:EGN34454.1} KW=Complete proteome; Reference proteome OX=658086 OS=Lachnospiraceae bacterium 3_1_57FAA_CT1. GN=HMPREF0994_04827 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MKYIKDLKEGDRVFDIYLCKHKQSAVTKNGKAYDNVILQDKTGTIDAKIWDPNSAGIAEF
DTLDYIEVYGDVNSFQGALQVSVKRVRLCEEGEYDPADYLPVSSKNIDDMYKQLLGFIGS
VENQYLKKLLESFFLEDESFIKAFRMSSAAKTVHHGFVGGLLEHTLSVTKLCEYYCTAYP
VLKRDLLITAAICHDIGKTKEISLFPENDYTDDGQLLGHIVMGTEMIGQKARTIPGFPPV
LEAELKHCILAHHGEYEYGSPKKPAIIEAAALNLADNTDAKMETFMEALQNAKDDGWLGY
NRLFESNIRMTRME
Download sequence
Identical sequences A0A1E3ALF8 F7KG48
WP_009254728.1.2903 WP_009254728.1.41561 WP_009254728.1.42117 WP_009254728.1.45371 WP_009254728.1.80991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]