SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7RPK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7RPK0
Domain Number - Region: 5-86
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0602
Family Capz alpha-1 subunit 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7RPK0
Sequence length 119
Comment (tr|F7RPK0|F7RPK0_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EGM69676.1} KW=Complete proteome OX=327275 OS=Shewanella sp. HN-41. GN=SOHN41_02288 OC=Shewanellaceae; Shewanella.
Sequence
MTEINAALAGFIENVKQHQTLWGLMDETGEGWVVCDSSEFEDTDVMPLWSSEAAAKSHCS
EEWHDYQAVSISLEEFLEYWVSDLNDDGVLIGVDWQTDEECLELDPIVLAKDLVDVEEV
Download sequence
Identical sequences F7RPK0
WP_007648782.1.13801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]