SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7VV61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7VV61
Domain Number 1 Region: 5-278
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.75e-84
Family Capz beta-1 subunit 0.000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7VV61
Sequence length 288
Comment (tr|F7VV61|F7VV61_SORMK) WGS project CABT00000000 data, contig 2.8 {ECO:0000313|EMBL:CCC09408.1} KW=Complete proteome; Reference proteome OX=771870 OS=K-hell). GN=SMAC_05175 OC=Sordaria.
Sequence
MATADPFDSALDLLRRLNPKHTAEHLNNLITLAPDLTEDLLSSVDQPLTVKRCKQTGRDY
LLCDYNRDGDSYRSPWSNQFDPPLEGGNQGGSGGDGDGEGEGGATGSIMPGERVRKMEIK
ANEAFDVYRELYYEGGVSSVYFWNLDDGFAGVVLLKKSSPTNPSSSGVWDSIHVFEASER
GRTSNYRLTSTVILSLATKGNTLGEVDLSGNMTRQVEQDLPVENDESHIANIGRLVEDME
LKMRNLLQEVYFGKAKDVVGDLRSVGSLSEGQRDRDAQMEIIGSMRKA
Download sequence
Identical sequences F7VV61
XP_003346977.1.50522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]