SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7XL24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7XL24
Domain Number - Region: 29-65
Classification Level Classification E-value
Superfamily KaiA/RbsU domain 0.00915
Family Phosphoserine phosphatase RsbU, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7XL24
Sequence length 69
Comment (tr|F7XL24|F7XL24_METZD) Uncharacterized protein {ECO:0000313|EMBL:AEH60732.1} KW=Complete proteome; Reference proteome OX=679901 OS=(Methanohalophilus zhilinae). GN=Mzhil_0870 OC=Methanosarcinaceae; Methanosalsum.
Sequence
MKILRCRDLGFNCGFITTGYDADELKKNMQEHIETIHRESFEKMDEDDKEDIKYRMDFLL
SRGCGCGAL
Download sequence
Identical sequences F7XL24
gi|336476810|ref|YP_004615951.1| WP_013898171.1.3471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]