SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7Y129 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7Y129
Domain Number - Region: 15-37
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.017
Family Preprotein translocase SecE subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7Y129
Sequence length 59
Comment (tr|F7Y129|F7Y129_MESOW) Cobalt transporter, subunit CbtB {ECO:0000313|EMBL:AEH88242.1} KW=Complete proteome OX=536019 OS=Mesorhizobium opportunistum (strain LMG 24607 / HAMBI 3007 / WSM2075). GN=Mesop_3804 OC=Phyllobacteriaceae; Mesorhizobium.
Sequence
MNTASVSLGTSVSSQSRFMQLALAALLGIFVVGFVGFSHIDAVHNAAHDYRHSMAFPCH
Download sequence
Identical sequences F7Y129
WP_013894925.1.95972 gi|337268281|ref|YP_004612336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]