SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8DGG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F8DGG9
Domain Number - Region: 54-110
Classification Level Classification E-value
Superfamily BAG domain 0.0173
Family BAG domain 0.011
Further Details:      
 
Domain Number - Region: 4-75
Classification Level Classification E-value
Superfamily G protein-binding domain 0.0335
Family Rabaptin-5 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8DGG9
Sequence length 119
Comment (tr|F8DGG9|F8DGG9_STREP) Uncharacterized protein {ECO:0000313|EMBL:AEH55418.1} KW=Complete proteome OX=760570 OS=/ LMG 14537). GN=HMPREF0833_10387 OC=Streptococcus.
Sequence
MNHDQQLSELRRQEDQLFQKEREIVREKRNLEDELNRFEGYSSDAHRYLWDAFESYPSSR
NFFDQLQEGFLHESRKISNSYLEELDELAIQKRKVEDDLNDIYHERKKLMIEKECDDGN
Download sequence
Identical sequences F8DGG9 I1ZLJ6
gi|337281875|ref|YP_004621346.1| gi|387879432|ref|YP_006309735.1| WP_013903470.1.15754 WP_013903470.1.25520 WP_013903470.1.38058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]