SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8MUV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8MUV1
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.79e-87
Family Capz alpha-1 subunit 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8MUV1
Sequence length 269
Comment (tr|F8MUV1|F8MUV1_NEUT8) Uncharacterized protein {ECO:0000313|EMBL:EGO54576.1} KW=Complete proteome OX=510951 OS=Neurospora tetrasperma (strain FGSC 2508 / ATCC MYA-4615 / P0657). GN=NEUTE1DRAFT_48330 OC=Neurospora.
Sequence
MASHKEIVSSFVEGAPPGELSDIKALTSSTPNLLNELGPAFQKYNEEQFATVKLPGGSQP
VIISSHSSLEDGRYYDVESSSSFAYDHITQKASDVQSHVLEGEQTDLVKSTVKGLSAYVK
EHFPNAAYGAYPIENDSKIAVVIVANKYSPNNFWNGRWRSLYIYDPSNNSIEGSIKVDVH
YYEDGNVRLLTNKTVTATVSSGTGSGIAKEISVNEKKYQEELNKSFTSLSEGAFKGLRRQ
LPVTRQKIEWDKVASYRLGQDIGGGSSRR
Download sequence
Identical sequences F8MUV1 G4V1X1
XP_009853806.1.73169 jgi|Neute1|72737|e_gw1.2.1080.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]