SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0FVS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0FVS1
Domain Number 1 Region: 44-243
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.85e-33
Family Leishmanolysin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0FVS1
Sequence length 278
Comment (tr|G0FVS1|G0FVS1_AMYMS) Zinc metalloendopeptidase {ECO:0000313|EMBL:AEK43380.1} KW=Complete proteome; Reference proteome OX=713604 OS=Amycolatopsis mediterranei (strain S699) (Nocardia mediterranei). GN=RAM_24500 OC=Amycolatopsis.
Sequence
MPDSQTYHARADAERARLLTGTTSPFTITVRFAGGLTRVQQDAFAAAADRWATVIVGDLP
DVVLDGEPIDDVLIVAKGADIDGVGHILGQAHITHVRPAGPERWALLPVRGEMTFDKADL
VKMEATGILGDVITHEMGHVLGVGSLWGPKGLLVGKGTSDPAFTGPAAMAEYHKLRGSGD
LVRVPVEDTGGPGTRDVHWRERTFGNELMTGFVGHAPNPLSRITAASLGDLGYQVDVDAA
DSYELPAAEVALTAAGVAVHALAVTPAPVELPRQAVRG
Download sequence
Identical sequences A0A0H3DAK9 G0FVS1
WP_013226645.1.26188 WP_013226645.1.53613 WP_013226645.1.63706 WP_013226645.1.79787 WP_013226645.1.88400 WP_013226645.1.99940 YP_003766981.1.66228 gi|399538573|ref|YP_006551235.1| gi|300786690|ref|YP_003766981.1| gi|532461434|ref|YP_008461086.1| gi|399538573|ref|YP_006551235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]