SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0LLH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0LLH2
Domain Number 1 Region: 7-222
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-70
Family DNA gyrase/MutL, N-terminal domain 0.000000797
Further Details:      
 
Domain Number 2 Region: 644-841
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.05e-68
Family Type II DNA topoisomerase 0.00092
Further Details:      
 
Domain Number 3 Region: 225-394
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.88e-55
Family DNA gyrase/MutL, second domain 0.00000604
Further Details:      
 
Domain Number 4 Region: 432-545,598-644
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.3e-23
Family Intein (protein splicing domain) 0.011
Further Details:      
 
Domain Number 5 Region: 397-434
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 0.0000000173
Family Type II DNA topoisomerase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0LLH2
Sequence length 849
Comment (tr|G0LLH2|G0LLH2_HALWC) DNA gyrase subunit B {ECO:0000313|EMBL:CCC40778.1} KW=Complete proteome OX=768065 OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23). GN=Hqrw_2980 OC=Haloquadratum.
Sequence
MSHETEYGAGDIQVLEGLEAVRKRPAMYIGSTDSRGLHHLVYEVVDNAIDEALAGHCDQI
DVTLHEDGSVSVADNGRGIPVDTHEQHDIPAVEVIMTVLHAGGKFDNKSYQVSGGLHGVG
VSVVNALSRWLEVEIKRDGALWRDRFEYGEPQPGAFERVRDLDSDEETGTTIRFWPSDDI
FETTEFEFSTLENRLRELAFLNSGVEICINGETDDINSKFCFNGGIREFVKYLDETKTVL
HDSVVHYQNEQDGIEVEVALQATEELQGSIHAFANNINTREGGTHLTGFKTALTRVINDY
GREHNLLDGFDSLQGEDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDVRGIVESTTHERL
GTYLEENPDVAKVIVRKAVEAAKARKAAKQAEELTRRKSALESTSLPGKLADCQSRDPAE
SELFIVEGDSAGGCFSGDTEIALASGDSITFESLVDAYERGETHYCYTIGDDGRIRIEEI
MNPRVTQEDAALLAVTLDNGEVIRCTPDHEFMLRDGNYCEAQNLTDGQSLMPLYRTTTEM
TETTETTGTAEMVKQPFAQNNWESVSQLANRYTRRHTTTDHIVETQQIQSQQQSQIETVQ
ISERADVHNHTVVSVESLTETADVYDLEVPVTHNFALASGVFVHNSAKQGRERRFQAILP
LKGKILNVEKHRLDRILENDEVRALITAIGAGIGDEFNVEDARYNRLIILSDADVDGAHI
RTLLLTLLYRHMRPLVEAGYVYAAKPPLYRIRYNGNTYDAMTKSERDQIISDVCNGNPTQ
VQRFKGLGEMNPEQLWETTMNPENRVLKQITVEDAAAADKMFSVLMGDAVEPRKEFIKDR
ATDAEWVDI
Download sequence
Identical sequences G0LLH2
WP_014556313.1.96088 gi|385804023|ref|YP_005840423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]