SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0MCK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0MCK0
Domain Number 1 Region: 10-119
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000116
Family Nucleotide and nucleoside kinases 0.097
Further Details:      
 
Domain Number 2 Region: 1-51,170-183,214-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000129
Family Shikimate kinase (AroK) 0.056
Further Details:      
 
Domain Number 3 Region: 381-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000262
Family HkH motif-containing C2H2 finger 0.046
Further Details:      
 
Weak hits

Sequence:  G0MCK0
Domain Number - Region: 279-313
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0942
Family Myosin S1 fragment, N-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0MCK0
Sequence length 419
Comment (tr|G0MCK0|G0MCK0_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT45768.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_11075 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MTTTPRKKPIIFVIGCTGTGKSDLGVAIAKKYGGEVISVDSMQFYKGLDIATNKITVEEA
EGVPHHMMSFLNPSDTSTYNVHHFKDTTLRLIQEIRSRSRIPILVGGTTYYAESILYENN
FIDSGKRTSSESSSSGGDSDSEEAKDDESTVSNQELWAELRRVDEKSAMLLHPNNRSRVW
RALQIFRDTGIPKSQHVELQKSDATVDLPGRLRSDDSLVIYMDATTEVLDERLDGRVDKM
IRMGLKKELMEFYEGHRQAIQHLKYGVMQCIGLKEFVPWLNLDPSERDTPTGDKLFKQGC
DDVKLHTRQYARRQRRWYKMRLLRRSDGDRKMASTKMLDTSDKTRIISDGMEIVDRWMGG
VDLFEEISPEPVLKGADANVILTCDVCSVTMTGRDNWRLHVGGKKHKHNVKKLKAQEQE
Download sequence
Identical sequences G0MCK0
135651.CBN11075 CBN11075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]