SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0MVH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0MVH9
Domain Number 1 Region: 3-237
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.84e-85
Family Capz beta-1 subunit 0.0000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0MVH9
Sequence length 238
Comment (tr|G0MVH9|G0MVH9_CAEBE) CBN-CAP-2 protein {ECO:0000313|EMBL:EGT44937.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_19802 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MGEQQLDCALDLMRRLPPQHCDKNLTDLIDLCPHLVDDLLSTIDQPLKIAADRETGKQYL
LCDYNRDGDSYRSPWSNTYDPPLEDGQLPSEKRRKMEVEANAAFESYRDLYFEGGVSSVY
FWDLDNGGFAGIVLIKKEGDGAKNITGCWDSIHVIEITERARQAHYKLTSTIMLWLQTNK
SVSGVMNLGGSLTRQHEMDAPINDQNTHLANMGRMIEDQESKMRLTINEIYFGKTKKA
Download sequence
Identical sequences G0MVH9
CBN19802 135651.CBN19802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]