SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0N4Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G0N4Y9
Domain Number - Region: 122-153
Classification Level Classification E-value
Superfamily LEA14-like 0.0235
Family LEA14-like 0.015
Further Details:      
 
Domain Number - Region: 88-123
Classification Level Classification E-value
Superfamily Protein-L-isoaspartyl O-methyltransferase, C-terminal domain 0.0275
Family Protein-L-isoaspartyl O-methyltransferase, C-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0N4Y9
Sequence length 188
Comment (tr|G0N4Y9|G0N4Y9_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT53018.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_06745 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MTKIYIPQLFCSFIRGGLMFFDCVIAFQMPSTTSVLVFISFLISTSFCITIELGNLQSVA
VNGKLLCNDKPANNIKVKLYEEEAILDVLLDERFTSEDGTFEMSGSKSEVTTIDPKLNIY
HKCNYDGVRFEEAIRYNNPNSFQICVRKISIMIPTEYITNGEKPARTYNIGEINLASKFS
GQSTDCFN
Download sequence
Identical sequences G0N4Y9
CBN06745 135651.CBN06745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]