SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0N6R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G0N6R4
Domain Number - Region: 41-112
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0837
Family Capz beta-1 subunit 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0N6R4
Sequence length 185
Comment (tr|G0N6R4|G0N6R4_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT54015.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_21441 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSQKTGMSQLRNGCSAAKTADAKSHEYETEVIILNQCRKLNGQIFIQRDYSKGLDVQFET
EYPARFTEKISRDTWENTIVNINKYFADAEAITGRSIFETIIGCVTCYASYLVMKSNYRR
KLDELQQYIDAQNQNIYHRVGFHIRNPMERGLRVLEIALLMRAGESPRDQPEQDVQEPNR
PIRTM
Download sequence
Identical sequences G0N6R4
CBN21441 135651.CBN21441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]