SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0PEK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G0PEK4
Domain Number - Region: 92-136
Classification Level Classification E-value
Superfamily Holliday junction resolvase RusA 0.0536
Family Holliday junction resolvase RusA 0.021
Further Details:      
 
Domain Number - Region: 128-217
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0654
Family Capz alpha-1 subunit 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0PEK4
Sequence length 271
Comment (tr|G0PEK4|G0PEK4_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT53086.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_22595 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MYPTIMEPVIGHNPIKESYRKPQSDYEKKLMCKTSLVTSVILALCLFAVLIVNIYPVNVG
GKPEPRNSPNYVSNDSYHFNSMKPVQLEYIWPDNVEKIVEDILDNNMHVTNDDRAVLIKT
ELMRFKTNDVFYIMVYDHTQSPNNQAFHGTQSEYITVSKPGKSNVVIYRSHYWRGSPENA
LTTVTKEIEETCSKGINSIPENYTDITRELYKNFHDINFLGIIDRKLDVSVRSANSFGRA
RGPGYWDTIPVLDSKTKERTGKEFILIAGYK
Download sequence
Identical sequences G0PEK4
135651.CBN22595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]