SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0QIT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G0QIT3
Domain Number - Region: 102-147
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0144
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0QIT3
Sequence length 163
Comment (tr|G0QIT3|G0QIT3_ICHMG) Uncharacterized protein {ECO:0000313|EMBL:EGR34819.1} KW=Complete proteome; Reference proteome OX=857967 OS=(Ich). GN=IMG5_000460 OC=Oligohymenophorea; Hymenostomatida; Ophryoglenina; Ichthyophthirius.
Sequence
MQEYDIEAKNIENELIQKQALEYQKAQEEFETVMPSIPKDSSEVLNLIKMEERLVKQSLF
IDAHKIKQQRIQLQKEVNKNFNLQRTNKLINQMNIFKQKQNQEQNALKQRIFQAKDELQK
ARNIELENTYKCFNFQILTNIKMKKNLESMIRLKKKTSLIITN
Download sequence
Identical sequences G0QIT3
gi|340509269|gb|EGR34819.1| XP_004040123.1.64148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]