SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0QYC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0QYC9
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-62
Family Capz beta-1 subunit 0.0000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0QYC9
Sequence length 279
Comment (tr|G0QYC9|G0QYC9_ICHMG) Uncharacterized protein {ECO:0000313|EMBL:EGR29792.1} KW=Complete proteome; Reference proteome OX=857967 OS=(Ich). GN=IMG5_148740 OC=Oligohymenophorea; Hymenostomatida; Ophryoglenina; Ichthyophthirius.
Sequence
MEQNKIATALSLLRKLPPSKIHYNTNALSNLMPDEADELLQKVDKPLEIGVCSQTNLQYI
KSEFNRDGDSFRSPHSNQYDPPIDDAVYPSNDVRQLEEKANTLFQEYMKLYYQGGICNIY
FWDKENGGFACAFLMKKEVELAKGIKKGTWDSINVVDVKVDEQNKKKITYKCTGSVVLEM
ILNDDGAGDVNISGSLTKSKEDVRLYDGNIDINSFHLENIGRIVEDLESVLRTHLDTIYV
GKTKENIFTTRSQEGYIQMEQTKKNLAINIIDRANNQKN
Download sequence
Identical sequences G0QYC9
XP_004031028.1.64148 gi|340503178|gb|EGR29792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]