SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0R2Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0R2Q3
Domain Number 1 Region: 8-74
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000139
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 
Weak hits

Sequence:  G0R2Q3
Domain Number - Region: 42-134
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00149
Family Capz beta-1 subunit 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0R2Q3
Sequence length 215
Comment (tr|G0R2Q3|G0R2Q3_ICHMG) Sperm flagellar protein 1, putative {ECO:0000313|EMBL:EGR28247.1} KW=Complete proteome; Reference proteome OX=857967 OS=(Ich). GN=IMG5_180470 OC=Oligohymenophorea; Hymenostomatida; Ophryoglenina; Ichthyophthirius.
Sequence
MEAPPITEEELNQLYNWIDTIPLTRSKKNITRDFADGCMMAEIIQHYLPKLVDVHNYSQA
HSITQKMYNWNTLNCNKNKQKNYMYIYIIIERVFRKMGFQISNIDIESIINSTPNAIERV
LKVVQIKIEKYIQEQKKRKEQESFVQQKQQQNVFQNQQNQGELIFKLQEKDKSNQELKET
IEILELKVKKMDQLVKLKDSKIQNLINKLSVAGLQ
Download sequence
Identical sequences G0R2Q3
XP_004027592.1.64148 gi|340501461|gb|EGR28247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]