SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0RN93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0RN93
Domain Number 1 Region: 4-263
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.89e-88
Family Capz alpha-1 subunit 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0RN93
Sequence length 272
Comment (tr|G0RN93|G0RN93_HYPJQ) Predicted protein {ECO:0000313|EMBL:EGR47342.1} KW=Complete proteome; Reference proteome OX=431241 OS=Hypocrea jecorina (strain QM6a) (Trichoderma reesei). GN=TRIREDRAFT_122743 OC=Trichoderma.
Sequence
MSHIETISSFVKGAPPGELADVVADIKALTASEPNVVDELAPAFEKYNEEQFITLKLPGS
SQPVLISPHNSLGGGRYYDVESSSSFEVDHLSQKASAVQSYVLEGAQTDLVKSTLKSLGT
YVKEHFPNAALGAYPVESDSKVAIVIVANKYSPNNFWNGRWRSVYTFDPSSGNLEGQIMV
DVHYYEDGNVRLLTNKAVSASIPSGTGAGIVKEIASTEKKYQEDLNKSFVSLSEGAFKGL
RRQLPVTRQKIEWERVTGYRLGQDIGGGSSKR
Download sequence
Identical sequences A0A024S6K7 A0A2H2ZLB9 G0RN93
jgi|Trire2|122743|estExt_fgenesh5_pg.C_140205 51453.JGI122743 XP_006966902.1.9351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]