SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0SA92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0SA92
Domain Number 1 Region: 419-658
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.02e-76
Family Capz alpha-1 subunit 0.00000694
Further Details:      
 
Domain Number 2 Region: 83-287
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.42e-65
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000497
Further Details:      
 
Domain Number 3 Region: 272-397
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.44e-34
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.000063
Further Details:      
 
Weak hits

Sequence:  G0SA92
Domain Number - Region: 669-715
Classification Level Classification E-value
Superfamily Head decoration protein D (gpD, major capsid protein D) 0.0785
Family Head decoration protein D (gpD, major capsid protein D) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0SA92
Sequence length 750
Comment (tr|G0SA92|G0SA92_CHATD) Putative F-actin-capping protein {ECO:0000313|EMBL:EGS19664.1} KW=Complete proteome; Reference proteome OX=759272 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719). GN=CTHT_0041430 OC=Chaetomium.
Sequence
MKRSTVVIRPSARALSRQASSQSFLLARSSALTSRQRRLYSTHPPNARLNLPIDYATTPL
LAHTSQAALSNPELPASVRNGTTKRMNLFQAINDALSTALAEDESVLIFGEDVAFGGVFR
CTTKLAETYGGDRVFNTPLTEQGIMGFAIGAAAEGMRPVAEIQFADYVFPAFDQLVNEAA
KFRYRDGAGGRSAGGLTVRMPCGGVGHGALYHSQSPEALFTHIPGLKVIIPRGPVQAKGL
LLAAIRSNDPCVVMEPKILYRAAVEQVPTTAYELPLGKAEILKEGKDVTVVSYGQPLYKC
MAALKAAEQDFGVSVELIDLRTIYPWDKETVFNSVRKTGRCVVVHEAMVNAGVGAEVAAA
IQEDPETFVRLEAPVARIAGWSIPTPLVFEQFNLPDVTTRGCRRRHVFLPKNYLALNLST
DIKNLTSSTPNLINELGPAFQKYNEEQFTTVKLPGSSQHVIISSHNSLGGSRYYDVETST
SFAFDHTTQKASAVETYVVEGAQGDLTKSVIKALAPYVKEHYSNAAYGAWPIENDSKVAI
IIVANKYSPNNYWNGRWRSLYILDPAAGTVEGSIKVDVHYYEDGNVRLLTDKPVTASVSA
TGAAIVKEISAVEKKYQEELNRSFASLSEGAFKALRRQLPVTRQKIEWEKIAGYRLGQDI
GGGGARRSDGDLVAPEPTWYPVLLRRRCGSGQQWDGRASGKRKTVAVQQREDREEGSTNF
DDAQATRSTYFQLYTLLCVSRFRIRKDHDF
Download sequence
Identical sequences G0SA92
XP_006694549.1.102047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]