SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0SDY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0SDY5
Domain Number 1 Region: 5-284
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.89e-84
Family Capz beta-1 subunit 0.0000000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0SDY5
Sequence length 286
Comment (tr|G0SDY5|G0SDY5_CHATD) Putative F-actin capping protein {ECO:0000313|EMBL:EGS18736.1} KW=Complete proteome; Reference proteome OX=759272 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719). GN=CTHT_0053450 OC=Chaetomium.
Sequence
MAAVDPFDSALDLLRRLNPKHTTSHLNNIIALAPDLAEDLLSSVDQPLTIRRCKQTGRDY
LLCDYNRDGDSYRSPWSNQFDPPLDDAPSVGGVGPGGTNEGAGEGAVPGERVRRMEIKMN
EAFDVYRELYYEGGVSSVYLWNLDDGFAGVVLLKKTSTPGDATSSGVWDSIHVFEASERG
RTSNYRLTSTVILSLATKGSSLGELDLSGNMTRQVEQDLPVDNDDSHIANIGRLVEDMEL
KMRNLLQEVYFGKAKDVVGDLRSIGSLSETLRDRETQRELIGSMRR
Download sequence
Identical sequences G0SDY5
XP_006695681.1.102047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]