SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1KU75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1KU75
Domain Number 1 Region: 10-275
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-71
Family Capz alpha-1 subunit 0.000000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1KU75
Sequence length 275
Comment (tr|G1KU75|G1KU75_ANOCA) Capping actin protein of muscle Z-line alpha subunit 3 {ECO:0000313|Ensembl:ENSACAP00000017341} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=CAPZA3 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MMLEADELPEEEKISFICGLLLQVPPGEFRNVFEDLRILIGDDHLMRQEAAQVSAYHTRN
NFTPVSIRGEEALVTRHNDLGGNRFFDPQIKLSFRFDHLSGRADKILIYHDFKRDTAELW
RETLNVTLESYVKKHFLSGICRVYQKTLRGSPFFVVCIEGHQYKKFWNAFWKSEWILPVT
PPSTQVAGSIVVQIHYFKKANLHFTATDSVGHSMYLINRAQFALDFEKLIEREHSKFQTG
LVESLQDLSDEVWQTLRRQLPVTRTAIRWNKLLTY
Download sequence
Identical sequences G1KU75
ENSACAP00000017341 XP_003220813.2.98722 28377.ENSACAP00000017341 ENSACAP00000017341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]